PDB entry 5wdz

View 5wdz on RCSB PDB site
Description: Structure of monomeric Interleukin-8 (1-66)
Class: cytokine
Keywords: Interleukin-8, chemokine-fold, CYTOKINE
Deposited on 2017-07-06, released 2017-11-29
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-8
  Species: Homo sapiens [TaxId:9606]
  Gene: CXCL8, IL8
  Database cross-references and differences (RAF-indexed):
  • Uniprot P10145 (0-65)
  Domains in SCOPe 2.06: d5wdza_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5wdzA (A:)
  sakelrcqciktyskpfhpkfikelrviesgphcanteiivklsdgrelcldpkenwvqr
  vvekfl