PDB entry 5wdd

View 5wdd on RCSB PDB site
Description: Crystal structure of chicken BOK
Class: apoptosis
Keywords: Bcl-2, Apoptosis, Pro-apoptotic, Cell death
Deposited on 2017-07-04, released 2018-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-09-09, with a file datestamp of 2020-09-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bcl-2-related ovarian killer protein
    Species: Gallus gallus [TaxId:9031]
    Gene: BOK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5wdda_
  • Chain 'B':
    Compound: Bcl-2-related ovarian killer protein
    Species: Gallus gallus [TaxId:9031]
    Gene: BOK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5wddb_
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wddA (A:)
    gplgsdrsptdkelvsqakalcrdyinsrliragvswskpehntpvpggklaevsaillr
    lgdeleyirpnvyrniarqlnislhsetvvtdaflavaaqiftagitwgkvvslyavaag
    lavdcvrhaqpamvhtivdclgefvrktlvtwlkrrggwaditkcvvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wddA (A:)
    sptdkelvsqakalcrdyinsrliragvswsgklaevsaillrlgdeleyirpnvyrnia
    rqlnislhsetvvtdaflavaaqiftagitwgkvvslyavaaglavdcvrhaqpamvhti
    vdclgefvrktlvtwlkrrggwaditkcvv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wddB (B:)
    gplgsdrsptdkelvsqakalcrdyinsrliragvswskpehntpvpggklaevsaillr
    lgdeleyirpnvyrniarqlnislhsetvvtdaflavaaqiftagitwgkvvslyavaag
    lavdcvrhaqpamvhtivdclgefvrktlvtwlkrrggwaditkcvvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wddB (B:)
    ptdkelvsqakalcrdyinsrliragvswskpehntpvpggklaevsaillrlgdeleyi
    rpnvyrniarqlnislhsetvvtdaflavaaqiftagitwgkvvslyavaaglavdcvrh
    aqpamvhtivdclgefvrktlvtwlkrrggwaditkcvv