PDB entry 5wcz

View 5wcz on RCSB PDB site
Description: Crystal Structure of Wild-Type MalL from Bacillus subtilis with TS analogue 1-deoxynojirimycin
Class: hydrolase
Keywords: TIM barrel; glucosidase; 1-deoxynojirimycin;, HYDROLASE
Deposited on 2017-07-03, released 2018-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligo-1,6-glucosidase 1
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: malL, yvdL, BSU34560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5wcza1, d5wcza2
  • Chain 'B':
    Compound: Oligo-1,6-glucosidase 1
    Species: BACILLUS SUBTILIS [TaxId:224308]
    Gene: malL, yvdL, BSU34560
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5wczb1, d5wczb2
  • Heterogens: NOJ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wczA (A:)
    msyyhhhhhhdydipttenlyfqgamgewwkeavvyqiyprsfydangdgfgdlqgviqk
    ldyiknlgadviwlspvfdspqddngydisdyknmyekfgtnedmfqlidevhkrgmkiv
    mdlvvnhtsdehawfaesrkskdnpyrdyylwkdpkpdgsepnnwgsifsgsawtydegt
    gqyylhyfskkqpdlnweneavrrevydvmrfwmdrgvdgwrmdvigsiskytdfpdyet
    dhsrsyivgryhsngprlhefiqemnrevlshydcmtvgeangsdieeakkytdasrqel
    nmiftfehmdidkeqnspngkwqikpfdlialkktmtrwqtglmnvgwntlyfenhdqpr
    visrwgndrklrkecakafatvlhgmkgtpfiyqgeeigmvnsdmplemyddleiknayr
    elvvenktmsekefvkavmikgrdhartpmqwdagkhagftagdpwipvnsryqdinvke
    sledqdsiffyyqkliqlrkqykimiygdyqllqendpqvfsylreyrgekllvvvnlse
    ekalfeappeliherwkvlisnypqeradlksislkpyeavmgisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wczA (A:)
    ewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddngy
    disdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpyr
    dyylwkdpkpdgsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrevy
    dvmrfwmdrgvdgwrmdvigsiskytdfpdyetrsyivgryhsngprlhefiqemnrevl
    shydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikpfdli
    alkktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgmkgtp
    fiyqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdhartpm
    qwdagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimiygdy
    qllqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqeradl
    ksislkpyeavmgisi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wczB (B:)
    msyyhhhhhhdydipttenlyfqgamgewwkeavvyqiyprsfydangdgfgdlqgviqk
    ldyiknlgadviwlspvfdspqddngydisdyknmyekfgtnedmfqlidevhkrgmkiv
    mdlvvnhtsdehawfaesrkskdnpyrdyylwkdpkpdgsepnnwgsifsgsawtydegt
    gqyylhyfskkqpdlnweneavrrevydvmrfwmdrgvdgwrmdvigsiskytdfpdyet
    dhsrsyivgryhsngprlhefiqemnrevlshydcmtvgeangsdieeakkytdasrqel
    nmiftfehmdidkeqnspngkwqikpfdlialkktmtrwqtglmnvgwntlyfenhdqpr
    visrwgndrklrkecakafatvlhgmkgtpfiyqgeeigmvnsdmplemyddleiknayr
    elvvenktmsekefvkavmikgrdhartpmqwdagkhagftagdpwipvnsryqdinvke
    sledqdsiffyyqkliqlrkqykimiygdyqllqendpqvfsylreyrgekllvvvnlse
    ekalfeappeliherwkvlisnypqeradlksislkpyeavmgisi
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wczB (B:)
    ewwkeavvyqiyprsfydangdgfgdlqgviqkldyiknlgadviwlspvfdspqddngy
    disdyknmyekfgtnedmfqlidevhkrgmkivmdlvvnhtsdehawfaesrkskdnpyr
    dyylwkdpkpdsepnnwgsifsgsawtydegtgqyylhyfskkqpdlnweneavrrevyd
    vmrfwmdrgvdgwrmdvigsiskytdfpdyetsyivgryhsngprlhefiqemnrevlsh
    ydcmtvgeangsdieeakkytdasrqelnmiftfehmdidkeqnspngkwqikpfdlial
    kktmtrwqtglmnvgwntlyfenhdqprvisrwgndrklrkecakafatvlhgmkgtpfi
    yqgeeigmvnsdmplemyddleiknayrelvvenktmsekefvkavmikgrdhartpmqw
    dagkhagftagdpwipvnsryqdinvkesledqdsiffyyqkliqlrkqykimiygdyql
    lqendpqvfsylreyrgekllvvvnlseekalfeappeliherwkvlisnypqeradlks
    islkpyeavmgisi