PDB entry 5wcw

View 5wcw on RCSB PDB site
Description: Phosphotriesterase variant S4
Class: hydrolase
Keywords: phosphotriesterase, organophosphate hydrolase, epistasis, directed evolution, laboratory evolution, HYDROLASE
Deposited on 2017-07-02, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotriesterase variant PTE-R1
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A060GZX0
      • conflict (200)
      • conflict (221)
      • conflict (260)
      • conflict (273)
    Domains in SCOPe 2.07: d5wcwa_
  • Chain 'G':
    Compound: Phosphotriesterase variant PTE-R1
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A060GZX0
      • conflict (200)
      • conflict (221)
      • conflict (260)
      • conflict (273)
    Domains in SCOPe 2.07: d5wcwg_
  • Heterogens: ZN, MPD, CAC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wcwA (A:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaifeseglspsrvcighsdatddlsyltalaargyligldsiphsaiglednasasahl
    girswqtrallikalidqgytkqilvsndwlfgissyvtnimdvmdsvnpdgmafiplrv
    ipflrekgipqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wcwA (A:)
    rintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraagv
    rtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflreiq
    ygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqaai
    feseglspsrvcighsdatddlsyltalaargyligldsiphsswqtrallikalidqgy
    tkqilvsndwlfgissyvtnimdvmdsvnpdgmafiplrvipflrekgipqetlagitvt
    nparflsptlr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5wcwG (G:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaifeseglspsrvcighsdatddlsyltalaargyligldsiphsaiglednasasahl
    girswqtrallikalidqgytkqilvsndwlfgissyvtnimdvmdsvnpdgmafiplrv
    ipflrekgipqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wcwG (G:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
    aifeseglspsrvcighsdatddlsyltalaargyligldsiphsswqtrallikalidq
    gytkqilvsndwlfgissyvtnimdvmdsvnpdgmafiplrvipflrekgipqetlagit
    vtnparflsptlr