PDB entry 5wck

View 5wck on RCSB PDB site
Description: Native FEZ-1 metallo-beta-lactamase from Legionella gormanii
Class: hydrolase
Keywords: Hydrolase
Deposited on 2017-06-30, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FEZ-1 protein
    Species: Fluoribacter gormanii [TaxId:464]
    Gene: blaFEZ-1, Lgor_2502
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K578 (0-262)
      • engineered mutation (228)
      • engineered mutation (262)
    Domains in SCOPe 2.07: d5wcka_
  • Chain 'B':
    Compound: FEZ-1 protein
    Species: Fluoribacter gormanii [TaxId:464]
    Gene: blaFEZ-1, Lgor_2502
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K578 (0-262)
      • engineered mutation (228)
      • engineered mutation (262)
    Domains in SCOPe 2.07: d5wckb_
  • Heterogens: ZN, SO4, GOL, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wckA (A:)
    aypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfk
    fsdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyft
    qstvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpg
    yklvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdpt
    gcknyieqkandfytelkkqetg
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5wckB (B:)
    aypmpnpfppfriagnlyyvgtddlasylivtprgnilinsdleanvpmikasikklgfk
    fsdtkillishahfdhaagselikqqtkakymvmdedvsvilsggksdfhyandsstyft
    qstvdkvlhdgervelggtvltahltpghtrgcttwtmklkdhgkqyqaviigsigvnpg
    yklvdnitypkiaedykhsikvlesmrcdiflgshagmfdlknkyvllskgqnnpfvdpt
    gcknyieqkandfytelkkqetg