PDB entry 5wc4

View 5wc4 on RCSB PDB site
Description: Crystal structure of biphenyl synthase from Malus domestic complexed with benzoyl-CoA
Class: transferase
Keywords: thiolase fold, polyketide synthase, TRANSFERASE
Deposited on 2017-06-29, released 2017-12-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: BIS3 biphenyl synthase
    Species: Malus domestica [TaxId:3750]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wc4a1, d5wc4a2
  • Chain 'B':
    Compound: BIS3 biphenyl synthase
    Species: Malus domestica [TaxId:3750]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5wc4b1, d5wc4b2
  • Heterogens: BU4, BYC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wc4A (A:)
    gsmaplvknepqhakilaigtanppnvyhqkdypdflfrvtknehrtdlrekfdriceks
    rtkkrylhlteemlkanpniytygapsldvrqdicnievpklgqeaalkaikewgqpisr
    ithlifctascvdmpgcdfqlikllgldpsvtrtmiyeagcyagatvlrmakdfaennkg
    arvlvvcaeittvffhgltdthldilvgqalfadgasavivganpepeierplfeivacr
    qtilpnsehgvvaniremgfnyylsgdvpkfvggnvvdfmtktfekvdgkkkdwnslffs
    vhpggpaivdqveeklglkegklratrhvlseygnmgaptvhfildemrnksieegkttt
    geglewgvvigigpgltvetavlrsesirc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wc4A (A:)
    qhakilaigtanppnvyhqkdypdflfrvtknehrtdlrekfdriceksrtkkrylhlte
    emlkanpniytygapsldvrqdicnievpklgqeaalkaikewgqpisrithlifctasc
    vdmpgcdfqlikllgldpsvtrtmiyeagcyagatvlrmakdfaennkgarvlvvcaeit
    tvffhgltdthldilvgqalfadgasavivganpepeierplfeivacrqtilpnsehgv
    vaniremgfnyylsgdvpkfvggnvvdfmtktfekvdgkkkdwnslffsvhpggpaivdq
    veeklglkegklratrhvlseygnmgaptvhfildemrnksieegktttgeglewgvvig
    igpgltvetavlrsesirc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5wc4B (B:)
    gsmaplvknepqhakilaigtanppnvyhqkdypdflfrvtknehrtdlrekfdriceks
    rtkkrylhlteemlkanpniytygapsldvrqdicnievpklgqeaalkaikewgqpisr
    ithlifctascvdmpgcdfqlikllgldpsvtrtmiyeagcyagatvlrmakdfaennkg
    arvlvvcaeittvffhgltdthldilvgqalfadgasavivganpepeierplfeivacr
    qtilpnsehgvvaniremgfnyylsgdvpkfvggnvvdfmtktfekvdgkkkdwnslffs
    vhpggpaivdqveeklglkegklratrhvlseygnmgaptvhfildemrnksieegkttt
    geglewgvvigigpgltvetavlrsesirc
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wc4B (B:)
    qhakilaigtanppnvyhqkdypdflfrvtknehrtdlrekfdriceksrtkkrylhlte
    emlkanpniytygapsldvrqdicnievpklgqeaalkaikewgqpisrithlifctasc
    vdmpgcdfqlikllgldpsvtrtmiyeagcyagatvlrmakdfaennkgarvlvvcaeit
    tvffhgltdthldilvgqalfadgasavivganpepeierplfeivacrqtilpnsehgv
    vaniremgfnyylsgdvpkfvggnvvdfmtktfekvdgkkkdwnslffsvhpggpaivdq
    veeklglkegklratrhvlseygnmgaptvhfildemrnksieegktttgeglewgvvig
    igpgltvetavlrsesir