PDB entry 5wbd

View 5wbd on RCSB PDB site
Description: Peroxide Activation Regulated by Hydrogen Bonds within Artificial Cu Proteins - N49A
Class: metal binding protein
Keywords: streptavidin, biotin, copper, hydroperoxo, secondary coordination sphere, hydrogen bond, biotin binding protein, METAL BINDING PROTEIN
Deposited on 2017-06-28, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (9-12)
      • engineered mutation (48)
    Domains in SCOPe 2.07: d5wbda1, d5wbda2
  • Heterogens: SI7, ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wbdA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgaaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wbdA (A:)
    mgrdeagitgtwynqlgstfivtagadgaltgtyesavgaaesryvltgrydsapatdgs
    gtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdt
    ftkvk