PDB entry 5wba

View 5wba on RCSB PDB site
Description: Peroxide Activation Regulated by Hydrogen Bonds within Artificial Cu Proteins - WT
Class: metal binding protein
Keywords: streptavidin, biotin, copper, hydroperoxo, secondary coordination sphere, hydrogen bond, biotin binding protein, METAL BINDING PROTEIN
Deposited on 2017-06-28, released 2017-11-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-13, with a file datestamp of 2017-12-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: streptavidin
    Species: Streptomyces avidinii [TaxId:1895]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22629 (13-End)
      • expression tag (9-12)
    Domains in SCOPe 2.07: d5wbaa1, d5wbaa2
  • Heterogens: SI8, ACT, SO4, CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wbaA (A:)
    masmtggqqmgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgry
    dsapatdgsgtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanaw
    kstlvghdtftkvkpsaasidaakkagvnngnpldavqq
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wbaA (A:)
    mgrdeagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgs
    gtalgwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdt
    ftkvk