PDB entry 5wb9

View 5wb9 on RCSB PDB site
Description: Crystal structure of CD4 binding site antibody N60P23 in complex with HIV-1 clade A/E strain 93TH057 gp120 core
Class: viral protein
Keywords: CD4 binding site, gp120 core, VIRAL PROTEIN
Deposited on 2017-06-28, released 2018-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-23, with a file datestamp of 2018-05-18.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'G':
    Compound: clade A/E 93TH057 HIV-1 gp120 core
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: HIV-1 ENV
    Database cross-references and differences (RAF-indexed):
    • Uniprot A0A0M3KKW9 (Start-352)
      • engineered mutation (241)
  • Chain 'H':
    Compound: N60P23 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WB9 (0-End)
  • Chain 'L':
    Compound: N60P23 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WB9
    Domains in SCOPe 2.07: d5wb9l1, d5wb9l2
  • Heterogens: NAG, MPD, MPO, HOH

PDB Chain Sequences:

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5wb9L (L:)
    cfvqsqspstlyasvgdkititcrssqsgwkawyqqkpgkapklliykssiletgvpsrf
    igsdsgteftltisslqpddfatyycqhfetfgqgtrvqvrrtvaapsvfifppsdeqlk
    sgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskady
    ekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wb9L (L:)
    spstlyasvgdkititcrssqsgwkawyqqkpgkapklliykssiletgvpsrfigsdsg
    teftltisslqpddfatyycqhfetfgqgtrvqvrrtvaapsvfifppsdeqlksgtasv
    vcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvy
    acevthqglsspvtksfnrg