PDB entry 5wb8

View 5wb8 on RCSB PDB site
Description: Crystal structure of the epidermal growth factor receptor extracellular region in complex with epigen
Class: signaling protein
Keywords: Receptor tyrosine kinase, growth factor, signaling, membrane protein, SIGNALING PROTEIN
Deposited on 2017-06-28, released 2017-10-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (Start-500)
      • expression tag (501-503)
  • Chain 'B':
    Compound: Epigen
    Species: Homo sapiens [TaxId:9606]
    Gene: EPGN, UNQ3072/PRO9904
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Epigen
    Species: Homo sapiens [TaxId:9606]
    Gene: EPGN, UNQ3072/PRO9904
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5wb8c_
  • Chain 'D':
    Compound: Epidermal growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: EGFR, ERBB, ERBB1, HER1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00533 (0-500)
      • expression tag (501-505)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5wb8C (C:)
    segpialkfshlcledhnsycingacafhhelekaicrcftgytgercehltltsyavds
    y
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wb8C (C:)
    sycingacafhhelekaicrcftgytgercehltlt
    

  • Chain 'D':
    No sequence available.