PDB entry 5wax

View 5wax on RCSB PDB site
Description: Crystal Structure of Sugarcane SAPK10 (serine/threonine-protein kinase 10)
Class: signaling protein
Keywords: serine/threonine kinase, abscisic acid-related SnRK2s, PLANT PROTEIN, SIGNALING PROTEIN, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2017-06-27, released 2018-08-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-08-15, with a file datestamp of 2018-08-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SAPK10 (serine/threonine-protein kinase 10)
    Species: Saccharum officinarum complex [TaxId:286192]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WAX (Start-309)
    Domains in SCOPe 2.07: d5waxa_
  • Chain 'B':
    Compound: SAPK10 (serine/threonine-protein kinase 10)
    Species: Saccharum officinarum complex [TaxId:286192]
    Database cross-references and differences (RAF-indexed):
    • PDB 5WAX (Start-309)
    Domains in SCOPe 2.07: d5waxb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5waxA (A:)
    smdmpimhdgdryelvrdigsgnfgvarlmrnradgqlvavkyiergekidenvqreiin
    hrslrhpniirfkeviltpthlaivmeyasggelfericnagrfsedearfffqqlisgv
    sychsmqvchrdlklentlldgstaprlkicdfgyskssvlhsqpkstvgtpayiapevl
    lkkeydgkvadvwscgvtlyvmlvgaypfedpdepknfrktiqrilgvqysipdyvhisp
    ecqdlisrifvanpatritipeirnhpwflknlpadlmddstmskqyeepeqpmqsmdei
    mqilaeatip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5waxA (A:)
    dmpimhdgdryelvrdigsgnfgvarlmrnradgqlvavkyiergekidenvqreiinhr
    slrhpniirfkeviltpthlaivmeyasggelfericnagrfsedearfffqqlisgvsy
    chsmqvchrdlklentlldgstaprlkicdfgytpayiapevllkkeydgkvadvwscgv
    tlyvmlvgaypfedpdepknfrktiqrilgvqysipdyvhispecqdlisrifvanpatr
    itipeirnhpwflknlpadlmdmqsmdeimqilaeatip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5waxB (B:)
    smdmpimhdgdryelvrdigsgnfgvarlmrnradgqlvavkyiergekidenvqreiin
    hrslrhpniirfkeviltpthlaivmeyasggelfericnagrfsedearfffqqlisgv
    sychsmqvchrdlklentlldgstaprlkicdfgyskssvlhsqpkstvgtpayiapevl
    lkkeydgkvadvwscgvtlyvmlvgaypfedpdepknfrktiqrilgvqysipdyvhisp
    ecqdlisrifvanpatritipeirnhpwflknlpadlmddstmskqyeepeqpmqsmdei
    mqilaeatip
    

    Sequence, based on observed residues (ATOM records): (download)
    >5waxB (B:)
    mpimhdgdryelvrdivarlmrnradgqlvavkyiergekidenvqreiinhrslrhpni
    irfkeviltpthlaivmeyasggelfericnagrfsedearfffqqlisgvsychsmqvc
    hrdlklentlldgstaprlkicdfgytvgtpayiapevllkkeydgkvadvwscgvtlyv
    mlvgaypfedpdepknfrktiqrilgvqysipdyvhispecqdlisrifvanpatritip
    eirnhpwflknlpadlmmqsmdeimqilaeatip