PDB entry 5wa6

View 5wa6 on RCSB PDB site
Description: Crystal structure of the influenza virus PA endonuclease in complex with an inhibitor - SRI-30007
Class: hydrolase/hydrolase inhibitor
Keywords: Virus, Nuclease, Transcription, Cap-snatching, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR complex
Deposited on 2017-06-25, released 2018-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-02, with a file datestamp of 2018-04-27.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polymerase acidic protein
    Species: Influenza A virus [TaxId:641501]
    Gene: PA
    Database cross-references and differences (RAF-indexed):
    • Uniprot C3W5S0 (20-69)
      • expression tag (16-19)
      • linker (70-72)
    • Uniprot C3W5S0 (73-End)
    Domains in SCOPe 2.07: d5wa6a1, d5wa6a2
  • Heterogens: KU7, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5wa6A (A:)
    mgsshhhhhhssglvprgshmedfvrqcfnpmivelaekamkeygedpkietnkfaaict
    hlevcfmysdggskhrfeiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfie
    igvtrrevhiyylekankiksekthihifsftgeematkadytldeesrariktrlftir
    qemasrslwdsfrqser
    

    Sequence, based on observed residues (ATOM records): (download)
    >5wa6A (A:)
    rgshmedfvrqcfnpmivelaekamkeygedpkietnkfaaicthlevcfmysdggskhr
    feiiegrdrimawtvvnsicnttgvekpkflpdlydykenrfieigvtrrevhiyyleka
    nkiekthihifsftgeematkadytldeesrariktrlftirqemasrslwdsfrqse