PDB entry 5w9a

View 5w9a on RCSB PDB site
Description: The structure of the Trim5alpha Bbox- coiled coil in complex LC3B
Class: antiviral protein
Keywords: Autophagy Trim5alpha LC3B Antiviral protein, ANTIVIRAL PROTEIN
Deposited on 2017-06-22, released 2018-10-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 2.74 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif-containing protein 5
    Species: Macaca mulatta [TaxId:9544]
    Gene: TRIM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PF16 (0-192)
      • engineered mutation (25-26)
  • Chain 'B':
    Compound: Tripartite motif-containing protein 5
    Species: Macaca mulatta [TaxId:9544]
    Gene: TRIM5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q0PF16 (0-192)
      • engineered mutation (25-26)
  • Chain 'C':
    Compound: Microtubule-associated proteins 1A/1B light chain 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3B, MAP1ALC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5w9ac_
  • Chain 'D':
    Compound: Microtubule-associated proteins 1A/1B light chain 3B
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP1LC3B, MAP1ALC3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5w9ad_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w9aC (C:)
    ektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
    ikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasqe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w9aD (D:)
    ektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
    ikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w9aD (D:)
    ektfkqrrtfeqrvedvrlireqhptkipviierykgekqlpvldktkflvpdhvnmsel
    ikiirrrlqlnanqaffllvnghsmvsvstpisevyesekdedgflymvyasq