PDB entry 5w8z

View 5w8z on RCSB PDB site
Description: Solution Structure of XPH2, a Hybrid Sequence of Xfaso 1 and Pfl 6, Two Cro Proteins With Different Folds
Class: transcription
Keywords: helix-turn-helix, structural evolution, conformational switch, metamorphic protein, disulfide bond, transcription factor, TRANSCRIPTION
Deposited on 2017-06-22, released 2018-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: xph2
  Species: Pseudomonas fluorescens PF5 [TaxId:1218948]
  Gene: cro
  Database cross-references and differences (RAF-indexed):
  • PDB 5W8Z (0-End)
  Domains in SCOPe 2.08: d5w8za1, d5w8za2

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >5w8zA (A:)
  mkkiplskyleehgtqsalaaalgvnqsaisqmvragrcidielytdgrvecrelrpdvf
  galehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >5w8zA (A:)
  mkkiplskyleehgtqsalaaalgvnqsaisqmvragrcidielytdgrvecrelrpdvf
  ga