PDB entry 5w8z

View 5w8z on RCSB PDB site
Description: Solution Structure of XPH2, a Hybrid Sequence of Xfaso 1 and Pfl 6, Two Cro Proteins With Different Folds
Class: transcription
Keywords: helix-turn-helix, structural evolution, conformational switch, metamorphic protein, disulfide bond, transcription factor, TRANSCRIPTION
Deposited on 2017-06-22, released 2018-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-11, with a file datestamp of 2018-07-06.
No data on structure quality are available

Chains and heterogens:

  • Chain 'A':
    Compound: xph2
    Species: Pseudomonas fluorescens PF5 [TaxId:1218948]
    Gene: cro
    Database cross-references and differences (RAF-indexed):
    • PDB 5W8Z (0-End)
    Domains in SCOPe 2.07: d5w8za1, d5w8za2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w8zA (A:)
    mkkiplskyleehgtqsalaaalgvnqsaisqmvragrcidielytdgrvecrelrpdvf
    galehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8zA (A:)
    mkkiplskyleehgtqsalaaalgvnqsaisqmvragrcidielytdgrvecrelrpdvf
    ga