PDB entry 5w8m

View 5w8m on RCSB PDB site
Description: Crystal structure of Chaetomium thermophilum Vps29
Class: endocytosis
Keywords: endosome, retromer, vps29, ENDOCYTOSIS
Deposited on 2017-06-21, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 1.52 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RZB5 (2-End)
      • expression tag (1)
    Domains in SCOPe 2.07: d5w8ma1, d5w8ma2
  • Chain 'B':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot G0RZB5 (2-End)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5w8mb1, d5w8mb2
  • Chain 'C':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8mc_
  • Chain 'D':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8md_
  • Chain 'E':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8me_
  • Chain 'F':
    Compound: Vacuolar protein sorting-associated protein 29
    Species: CHAETOMIUM THERMOPHILUM [TaxId:209285]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8mf_
  • Heterogens: PGE, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w8mA (A:)
    gsmaflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdl
    kivrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwagg
    shrfecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrkde
    ngtenvavekvtytkpveptgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8mA (A:)
    smaflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdlk
    ivrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwaggs
    hrfecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrkden
    gtenvavekvtytkpv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w8mB (B:)
    gsmaflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdl
    kivrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwagg
    shrfecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrkde
    ngtenvavekvtytkpveptgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8mB (B:)
    gsmaflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdl
    kivrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwagg
    shrfecfeymdkffvnpgsatgafttdvvpsfclmdvqgisltlyvyqlrkdengtenva
    vekvtytkp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w8mC (C:)
    gsmaflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdl
    kivrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwagg
    shrfecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrkde
    ngtenvavekvtytkpveptgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8mC (C:)
    aflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdlkiv
    rgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwaggshr
    fecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrktenva
    vekvtytkp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w8mD (D:)
    gsmaflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdl
    kivrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwagg
    shrfecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrkde
    ngtenvavekvtytkpveptgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8mD (D:)
    aflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdlkiv
    rgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwaggshr
    fecfeymdkffvnpgsatgafttdwevvpsfclmdvqgisltlyvyqlrkdengtenvav
    ekvtytkpveptgas
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5w8mE (E:)
    gsmaflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdl
    kivrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwagg
    shrfecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrkde
    ngtenvavekvtytkpveptgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8mE (E:)
    aflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdlkiv
    rgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwaggshr
    fecfeymdkffvnpgsatgafttdevvpsfclmdvqgisltlyvyqlrkdengtenvave
    kvtytkp
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5w8mF (F:)
    gsmaflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdl
    kivrgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwagg
    shrfecfeymdkffvnpgsatgafttdwlaegeevvpsfclmdvqgisltlyvyqlrkde
    ngtenvavekvtytkpveptgas
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8mF (F:)
    aflilvignlhipdraldippkfkkllspgkisqtlclgnltdratydylrsispdlkiv
    rgrmdveatslplmqvvthgslrigflegftlvseepdvllaeankldvdvlcwaggshr
    fecfeymdkffvnpgsatgafttvvpsfclmdvqgisltlyvyqlrkdengtenvavekv
    tytkp