PDB entry 5w8l

View 5w8l on RCSB PDB site
Description: Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 59 and NADH
Class: oxidoreductase
Keywords: oxidoreductase, oxidoreductase inhibitor
Deposited on 2017-06-21, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8la1, d5w8la2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8lb1, d5w8lb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8lc1, d5w8lc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8ld1, d5w8ld2
  • Heterogens: NAI, 9YA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w8lA (A:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8lA (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w8lB (B:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8lB (B:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w8lC (C:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8lC (C:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w8lD (D:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8lD (D:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf