PDB entry 5w8h

View 5w8h on RCSB PDB site
Description: Crystal Structure of Lactate Dehydrogenase A in complex with inhibitor compound 11
Class: oxidoreductase
Keywords: oxidoreductase, oxidoreductase inhibitor
Deposited on 2017-06-21, released 2018-01-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8ha1, d5w8ha2
  • Chain 'B':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8hb1, d5w8hb2
  • Chain 'C':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8hc1, d5w8hc2
  • Chain 'D':
    Compound: L-lactate dehydrogenase A chain
    Species: Homo sapiens [TaxId:9606]
    Gene: LDHA, PIG19
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w8hd1, d5w8hd2
  • Heterogens: 9Y1, ACT, DMS, MLA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w8hA (A:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8hA (A:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w8hB (B:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8hB (B:)
    atlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkge
    mmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfii
    pnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvh
    plschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayev
    iklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngis
    dlvkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w8hC (C:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8hC (C:)
    atlkdqliynllketpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
    dlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpl
    schgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayevik
    lkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngisdl
    vkvtltseeearlkksadtlwgiqkelqf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w8hD (D:)
    matlkdqliynllkeeqtpqnkitvvgvgavgmacaisilmkdladelalvdviedklkg
    emmdlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfi
    ipnvvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgv
    hplschgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesaye
    viklkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngi
    sdlvkvtltseeearlkksadtlwgiqkelqf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w8hD (D:)
    atlkdqliynllketpqnkitvvgvgavgmacaisilmkdladelalvdviedklkgemm
    dlqhgslflrtpkivsgkdynvtansklviitagarqqegesrlnlvqrnvnifkfiipn
    vvkyspnckllivsnpvdiltyvawkisgfpknrvigsgcnldsarfrylmgerlgvhpl
    schgwvlgehgdssvpvwsgmnvagvslktlhpdlgtdkdkeqwkevhkqvvesayevik
    lkgytswaiglsvadlaesimknlrrvhpvstmikglygikddvflsvpcilgqngisdl
    vkvtltseeearlkksadtlwgiqkelqf