PDB entry 5w7h

View 5w7h on RCSB PDB site
Description: Supercharged arPTE variant R5
Class: hydrolase
Keywords: supercharged, organophosphate hydrolase, OP hydrolase, surface modification, OpdA, PTE, phosphotriesterase, HYDROLASE
Deposited on 2017-06-19, released 2019-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2019-01-23, with a file datestamp of 2019-01-18.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphotriesterase
    Species: Rhizobium radiobacter [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7
      • conflict (55)
      • conflict (67)
      • conflict (123)
      • conflict (130)
      • conflict (160)
      • conflict (179)
      • conflict (213)
      • conflict (238)
      • conflict (290)
    Domains in SCOPe 2.07: d5w7ha_
  • Chain 'B':
    Compound: phosphotriesterase
    Species: Rhizobium radiobacter [TaxId:358]
    Gene: opdA
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q93LD7
      • conflict (55)
      • conflict (67)
      • conflict (123)
      • conflict (130)
      • conflict (160)
      • conflict (179)
      • conflict (213)
      • conflict (238)
      • conflict (290)
    Domains in SCOPe 2.07: d5w7hb_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w7hA (A:)
    msmarpigtgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalvekav
    rglrharaagvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsve
    eltrfflreirhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsg
    sqrdgeqqaaifeseglspsrvcighsddtddlryltglaargylvgldrmpysaiglrg
    nasalalfgtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimrvmdrinpdg
    mafvplrvipflrekgvppetlagvtvanparflsptvras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w7hA (A:)
    gdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalvekavrglrharaa
    gvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltrfflre
    irhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsgsqrdgeqqa
    aifeseglspsrvcighsddtddlryltglaargylvgldrmpysaiglrgnasalalfg
    trswqtrallikalidrgykdrilvshdwlfgfssyvtnimrvmdrinpdgmafvplrvi
    pflrekgvppetlagvtvanparflsptv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w7hB (B:)
    msmarpigtgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalvekav
    rglrharaagvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsve
    eltrfflreirhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsg
    sqrdgeqqaaifeseglspsrvcighsddtddlryltglaargylvgldrmpysaiglrg
    nasalalfgtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimrvmdrinpdg
    mafvplrvipflrekgvppetlagvtvanparflsptvras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w7hB (B:)
    tgdlintvrgpipvseagftlthehicgssagflrawpeffgsrkalvekavrglrhara
    agvqtivdvstfdigrdvrllaevsraadvhivaatglwfdpplsmrmrsveeltrfflr
    eirhgiedtgiragiikvattgkatpfqelvlraaaraslatgvpvtthtsgsqrdgeqq
    aaifeseglspsrvcighsddtddlryltglaargylvgldrmpysaiglrgnasalalf
    gtrswqtrallikalidrgykdrilvshdwlfgfssyvtnimrvmdrinpdgmafvplrv
    ipflrekgvppetlagvtvanparflspt