PDB entry 5w6y

View 5w6y on RCSB PDB site
Description: Physcomitrella patens Chorismate Mutase
Class: BIOSYNTHETIC PROTEIN,isomerase
Keywords: chorismate mutase, BIOSYNTHETIC PROTEIN, isomerase
Deposited on 2017-06-18, released 2017-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chorismate mutase
    Species: Physcomitrella patens [TaxId:3218]
    Gene: PHYPADRAFT_181106
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5w6ya_
  • Chain 'B':
    Compound: chorismate mutase
    Species: Physcomitrella patens [TaxId:3218]
    Gene: PHYPADRAFT_181106
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5w6yb_
  • Heterogens: TRP, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w6yA (A:)
    macalsvsgilcasqaatsfssakptksqphpvqlkafvpisqpaalksaslvvspsrts
    hasveaetepftlanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslve
    fmlketetlhakvrryqapdehpffpedlsqpilpslpksrvlhpaaekininksiwsmy
    lqdllpkltvpdddgnygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaq
    dgdailreltfknvednvkrrvankaraygqevnehgkvdnarykidpdlagalyedwvm
    pltkqvqvayllrrld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w6yA (A:)
    lanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslvefmlketetlhak
    vrryqapdehpffpedlsqpilpslpksrvlhpaaekininksiwsmylqdllpkltvpd
    ddgnygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaqdgdailreltfk
    nvednvkrrvankaraygqevnehgkvdnarykidpdlagalyedwvmpltkqvqvayll
    rrld
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w6yB (B:)
    macalsvsgilcasqaatsfssakptksqphpvqlkafvpisqpaalksaslvvspsrts
    hasveaetepftlanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslve
    fmlketetlhakvrryqapdehpffpedlsqpilpslpksrvlhpaaekininksiwsmy
    lqdllpkltvpdddgnygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaq
    dgdailreltfknvednvkrrvankaraygqevnehgkvdnarykidpdlagalyedwvm
    pltkqvqvayllrrld
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w6yB (B:)
    epftlanireslirqedtiiyallqraqfsfnaptydensfsipgfkgslvefmlketet
    lhakvrryqapdehpffpedlsqprvlhpaaekininksiwsmylqdllpkltvpdddgn
    ygsasvcdvlclqalskrihygkfvaeakfiedparfeghikaqdgdailreltfknved
    nvkrrvankaraygqerykidpdlagalyedwvmpltkqvqvayllrrld