PDB entry 5w6g

View 5w6g on RCSB PDB site
Description: Human antibody 6649 in complex with influenza hemagglutinin H1 Solomon Islands
Class: viral protein/immune system
Keywords: Antibody, FAB, Influenza H1N1, VIRAL PROTEIN-IMMUNE SYSTEM complex
Deposited on 2017-06-16, released 2017-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemagglutinin HA1
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed):
    • Uniprot A7UPX0 (8-End)
      • expression tag (4-7)
    Domains in SCOPe 2.07: d5w6ga1, d5w6ga2
  • Chain 'B':
    Compound: hemagglutinin HA2
    Species: Influenza A virus (A/Solomon Islands/3/2006(H1N1)) [TaxId:464623]
    Gene: HA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w6gb_
  • Chain 'H':
    Compound: 6649 antibody heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W6G (0-116)
    • Uniprot S6B2B6 (117-End)
      • conflict (124)
      • conflict (147)
  • Chain 'L':
    Compound: 6649 antibody light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W6G (Start-116)
    • Uniprot Q6GMX4 (117-End)
    Domains in SCOPe 2.07: d5w6gl1, d5w6gl2
  • Heterogens: NAG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w6gA (A:)
    adpgylledticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplql
    gncsvagwilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssfe
    rfeifpkesswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekev
    lvlwgvhhppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtl
    lepgdtiifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfq
    nvhpvtigecpkyvrsaklrmvtglrnipsiqsr
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w6gA (A:)
    ylledticigyhannstdtvdtvleknvtvthsvnlledshngklcllkgiaplqlgncs
    vagwilgnpecellisreswsyivekpnpengtcypghfadyeelreqlssvssferfei
    fpkesswpnhtttgvsascshngessfyknllwltgknglypnlsksyannkekevlvlw
    gvhhppnigdqralyhtenayvsvvsshysrkftpeiakrpkvrdregrinyywtllepg
    dtiifeangnliapryafalsrgfgsgiinsnapmdecdakcqtpqgainsslpfqnvhp
    vtigecpkyvrsaklrmvtglrnips
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w6gB (B:)
    glfgaiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmn
    tqftavgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlye
    kvksqlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrekidgvrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w6gB (B:)
    aiagfieggwtgmvdgwygyhhqneqgsgyaadqkstqnaingitnkvnsviekmntqft
    avgkefnklerrmenlnkkvddgfidiwtynaellvllenertldfhdsnvknlyekvks
    qlknnakeigngcfefyhkcndecmesvkngtydypkyseesklnrek
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5w6gL (L:)
    qsvltqppsvsgapgqrvsisctgthsnigagfdvhwyqqlpgtapklliyannnrpsgv
    pdrfsgsksgssaslaitglqaedeadyycqsfdsilsgdlvfgggtkltvlgqpkgaps
    vtlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaa
    ssylsltpeqwkshrsyscqvthegstvektvaptecs
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w6gL (L:)
    svltqppsvsgapgqrvsisctgthsnigagfdvhwyqqlpgtapklliyannnrpsgvp
    drfsgsksgssaslaitglqaedeadyycqsfdsilsgdlvfgggtkltvlgqpkgapsv
    tlfppsseelqankatlvclisdfypgavtvawkadsspvkagvetttpskqsnnkyaas
    sylsltpeqwkshrsyscqvthegstvektvapt