PDB entry 5w6b

View 5w6b on RCSB PDB site
Description: Phosphotriesterase variant S1
Class: hydrolase
Keywords: phosphotriesterase, organophosphate hydrolase, epistasis, directed evolution, laboratory evolution, HYDROLASE
Deposited on 2017-06-16, released 2018-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-12-12, with a file datestamp of 2018-12-07.
Experiment type: XRAY
Resolution: 1.74 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphotriesterase variant PTE-R1
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w6ba_
  • Chain 'G':
    Compound: Phosphotriesterase variant PTE-R1
    Species: Brevundimonas diminuta [TaxId:293]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w6bg_
  • Heterogens: ZN, CAC, MPD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w6bA (A:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaifeseglspsrvcighsddtddlsyltalaargyligldsiphsaiglednasasall
    girswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrv
    ipflrekgipqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w6bA (A:)
    drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraag
    vrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflrei
    qygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqaa
    ifeseglspsrvcighsddtddlsyltalaargyligldsiphsaiglednasasallgi
    rswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvip
    flrekgipqetlagitvtnparflsptlr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5w6bG (G:)
    mgdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrara
    agvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflr
    eiqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqq
    aaifeseglspsrvcighsddtddlsyltalaargyligldsiphsaiglednasasall
    girswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrv
    ipflrekgipqetlagitvtnparflsptlras
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w6bG (G:)
    gdrintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrraraa
    gvrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflre
    iqygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqa
    aifeseglspsrvcighsddtddlsyltalaargyligldsiphsaiglednasasallg
    irswqtrallikalidqgymkqilvsndwlfgfssyvtnimdvmdsvnpdgmafiplrvi
    pflrekgipqetlagitvtnparflsptlr