PDB entry 5w63

View 5w63 on RCSB PDB site
Description: Crystal structure of channel catfish BAX
Class: apoptosis
Keywords: BAX, monomer, catfish, APOPTOSIS
Deposited on 2017-06-16, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAX
    Species: Ictalurus punctatus [TaxId:7998]
    Gene: BAX
    Database cross-references and differences (RAF-indexed):
    • Uniprot E3TFZ1
      • engineered mutation (50)
      • engineered mutation (116)
    Domains in SCOPe 2.07: d5w63a_
  • Heterogens: SO4, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w63A (A:)
    masgegdgtsndqilevgavllkdfiyervhrhgdsgtvvsrhelggselsdpthkklaq
    ylqqigdeldnnvdlqrmladsalqptkevfvkvareifsdgkfnwgrvvalfyfasrlv
    iealltkipdiirtiinwtldylrehvinwireqggwegiqtyfgtptwktvgvflagvl
    ttvlvmrkm
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w63A (A:)
    tsndqilevgavllkdfiyervhrhtvvsrhelggselsdpthkklaqylqqigdeldnn
    vdlqrmladsalqptkevfvkvareifsdgkfnwgrvvalfyfasrlviealltkipdii
    rtiinwtldylrehvinwireqggwegiqtyfgtptwktvgvflagvlttvlvm