PDB entry 5w62

View 5w62 on RCSB PDB site
Description: Crystal structure of mouse BAX monomer
Class: apoptosis
Keywords: BAX, monomer, mouse, APOPTOSIS
Deposited on 2017-06-16, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAX
    Species: Mus musculus [TaxId:10090]
    Gene: BAX
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07813
      • engineered mutation (61)
    Domains in SCOPe 2.07: d5w62a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w62A (A:)
    mdgsgeqlgsggptsseqimktgafllqgfiqdragrmagetpeltleqppqdastkkls
    eslrrigdeldsnmelqrmiadvdtdsprevffrvaadmfadgnfnwgrvvalfyfaskl
    vlkalstkvpelirtimgwtldflrerllvwiqdqggwegllsyfgtptwqtvtifvagv
    ltasltiwkkmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w62A (A:)
    ptsseqimktgafllqgfiqdradastkklseslrrigdeldsnmelqrmiadvdtdspr
    evffrvaadmfadgnfnwgrvvalfyfasklvlkalpelirtimgwtldflrerllvwiq
    dqggwegllsyfgtptwqtvtifvagvltasltiwk