PDB entry 5w60

View 5w60 on RCSB PDB site
Description: Crystal structure of BAXP168G monomer cryo-protected with ethylene glycol
Class: apoptosis
Keywords: BAX, inactive monomer, APOPTOSIS
Deposited on 2017-06-16, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apoptosis regulator BAX
    Species: Homo sapiens [TaxId:9606]
    Gene: BAX, BCL2L4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07812
      • engineered mutation (61)
      • engineered mutation (125)
      • engineered mutation (167)
    Domains in SCOPe 2.07: d5w60a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w60A (A:)
    mdgsgeqprgggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkkls
    eslkrigdeldsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfaskl
    vlkalstkvpelirtimgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagv
    ltasltiwkkmgss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w60A (A:)
    ggptsseqimktgalllqgfiqdragrmggeapelaldpvpqdastkklseslkrigdel
    dsnmelqrmiaavdtdsprevffrvaadmfsdgnfnwgrvvalfyfasklvlkalstkvp
    elirtimgwtldflrerllgwiqdqggwdgllsyfgtgtwqtvtifvagvltasltiwk