PDB entry 5w5w

View 5w5w on RCSB PDB site
Description: HIV Protease (PR) in open form with Mg2+ in active site and HIVE-9 in eye site
Class: hydrolase
Keywords: protease, allostery, fragment binding, exosite, HYDROLASE
Deposited on 2017-06-15, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-01-01, with a file datestamp of 2019-12-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Q8V9 (0-98)
      • conflict (6)
      • conflict (32)
      • conflict (62)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.08: d5w5wa_
  • Chain 'B':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: pol
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8Q8V9 (0-98)
      • conflict (6)
      • conflict (32)
      • conflict (62)
      • conflict (66)
      • conflict (94)
    Domains in SCOPe 2.08: d5w5wb_
  • Heterogens: 3TL, HV9, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w5wA (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemnlpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w5wB (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemnlpgrwkpkmiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf