PDB entry 5w5q

View 5w5q on RCSB PDB site
Description: MAP4K4 in complex with inhibitor compound 12 (N3-methyl-10-(3-methyl-3-(5-methyloxazol-2-yl)but-1-yn-1-yl)-6,7-dihydro-5H-5,7-methanobenzo[c]imidazo[1,2-a]azepine-2,3-dicarboxamide)
Class: transferase/transferase inhibitor
Keywords: kinase, TRANSFERASE, TRANSFERASE-TRANSFERASE INHIBITOR complex
Deposited on 2017-06-15, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.33 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase kinase kinase kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP4K4, HGK, KIAA0687, NIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w5qa_
  • Chain 'B':
    Compound: Mitogen-activated protein kinase kinase kinase kinase 4
    Species: Homo sapiens [TaxId:9606]
    Gene: MAP4K4, HGK, KIAA0687, NIK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w5qb_
  • Heterogens: 9X4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w5qA (A:)
    gsandspakslvdidlsslrdpagifelvevvgngtygqvykgrhvktgqlaaikvmdvt
    edeeeeikleinmlkkyshhrniatyygafikksppghddqlwlvmefcgagsitdlvkn
    tkgntlkedwiayisreilrglahlhihhvihrdikgqnvlltenaevklvdfgvsaqld
    rtvgrrntfigtpywmapeviacdenpdatydyrsdlwscgitaiemaegapplcdmhpm
    ralfliprnppprlkskkwskkffsfiegclvknymqrpsteqllkhpfirdqpnerqvr
    iqlkdhidrtrkkrgekdeteyeysgseegns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w5qA (A:)
    slrdpagifelvevvgngtygqvykgrhvktgqlaaikvmdvtedeeeeikleinmlkky
    shhrniatyygafikksddqlwlvmefcgagsitdlvkntkgntlkedwiayisreilrg
    lahlhihhvihrdikgqnvlltenaevklvdfgvsaqldrtvgrrntfigtpywmapevi
    acdenpdatydyrsdlwscgitaiemaegapplcdmhpmralfliprnppprlkskkwsk
    kffsfiegclvknymqrpsteqllkhpfirdqpnerqvriqlkdhidrtrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w5qB (B:)
    gsandspakslvdidlsslrdpagifelvevvgngtygqvykgrhvktgqlaaikvmdvt
    edeeeeikleinmlkkyshhrniatyygafikksppghddqlwlvmefcgagsitdlvkn
    tkgntlkedwiayisreilrglahlhihhvihrdikgqnvlltenaevklvdfgvsaqld
    rtvgrrntfigtpywmapeviacdenpdatydyrsdlwscgitaiemaegapplcdmhpm
    ralfliprnppprlkskkwskkffsfiegclvknymqrpsteqllkhpfirdqpnerqvr
    iqlkdhidrtrkkrgekdeteyeysgseegns
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w5qB (B:)
    idlsslrdpagifelvevvgnggqvykgrhvktgqlaaikvmdvtedeeeeikleinmlk
    kyshhrniatyygafikksppghddqlwlvmefcgagsitdlvkntkgntlkedwiayis
    reilrglahlhihhvihrdikgqnvlltenaevklvdfgvsaqldrtvgrrntfigtpyw
    mapeviacdenpdatydyrsdlwscgitaiemaegapplcdmhpmralfliprnppprlk
    skkwskkffsfiegclvknymqrpsteqllkhpfirdqpnerqvriqlkdhidrtrk