PDB entry 5w55

View 5w55 on RCSB PDB site
Description: Crystal Structure of the first bromodomain of human BRD4 in complex with the inhibitor JWG048
Class: cell cycle
Keywords: Kinase, Inhibitor, CELL CYCLE
Deposited on 2017-06-14, released 2018-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: N/A
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bromodomain-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: BRD4, HUNK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5w55a_
  • Heterogens: X30, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w55A (A:)
    stnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykii
    ktpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqki
    nelptee
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w55A (A:)
    tnppppetsnpnkpkrqtnqlqyllrvvlktlwkhqfawpfqqpvdavklnlpdyykiik
    tpmdmgtikkrlennyywnaqeciqdfntmftncyiynkpgddivlmaealeklflqkin
    elp