PDB entry 5w4p

View 5w4p on RCSB PDB site
Description: Structure of the E28A mutant of the HIV-1 capsid protein
Class: viral protein
Keywords: capsid protein, VIRAL PROTEIN
Deposited on 2017-06-12, released 2018-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-20, with a file datestamp of 2018-06-15.
Experiment type: XRAY
Resolution: 2.19 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: capsid protein p24
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot B6DRA0 (0-End)
      • engineered mutation (27)
    Domains in SCOPe 2.07: d5w4pa1, d5w4pa2
  • Heterogens: IOD, CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w4pA (A:)
    pivqnlqgqmvhqaisprtlnawvkvvaekafspevipmfsalsegatpqdlntmlntvg
    ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
    nppipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqe
    vknwmtetllvqnanpdcktilkalgpgatleemmtacqgvggpghkarvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w4pA (A:)
    pivqqgqmvhqaisprtlnawvkvvaekafspevipmfsalsegatpqdlntmlntvggh
    qaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmthnp
    pipvgeiykrwiilglnkivrmysptsildirqgpkepfrdyvdrfyktlraeqasqevk
    nwmtetllvqnanpdcktilkalgpgatleemmtacqgv