PDB entry 5w3m

View 5w3m on RCSB PDB site
Description: CryoEM structure of rhinovirus B14 in complex with C5 Fab (33 degrees Celsius, molar ratio 1:1, full particle)
Class: virus/immune system
Keywords: virus, antibody, VIRUS-IMMUNE SYSTEM complex
Deposited on 2017-06-08, released 2017-07-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-08-09, with a file datestamp of 2017-08-04.
Experiment type: EM
Resolution: 2.26 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: viral protein 1
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w3ma_
  • Chain 'B':
    Compound: viral protein 3
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w3mb_
  • Chain 'C':
    Compound: viral protein 2
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: viral protein 4
    Species: Human rhinovirus 14 [TaxId:12131]
    Database cross-references and differences (RAF-indexed):
  • Chain 'E':
    Compound: C5 antibody variable heavy domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W3M (0-115)
    Domains in SCOPe 2.07: d5w3me_
  • Chain 'G':
    Compound: C5 antibody variable light domain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W3M (0-106)
    Domains in SCOPe 2.07: d5w3mg_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w3mA (A:)
    glgdeleevivektkqtvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhf
    ngsetdvecflgraacvhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelft
    yvrfdseytilatasqpdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkv
    gdtsrfsvpyvglasayncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvk
    irvyhrakhveawiprapralpytsigrtnypkntepvikkrkgdiksy
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w3mA (A:)
    tvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetdvecflgraac
    vhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfdseytilatasq
    pdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrfsvpyvglasa
    yncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhrakhveawipr
    apralpytsigrtnypkntepvikkrkgdiksy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w3mB (B:)
    glptttlpgsgqflttddrqspsalpnyeptprihipgkvhnlleiiqvdtlipmnntht
    kdevnsyliplnanrqneqvfgtnlfigdgvfkttllgeivqyythwsgslrfslmytgp
    alssaklilaytppgargpqdrreamlgthvvwdiglqstivmtipwtsgvqfrytdpdt
    ytsagflscwyqtslilppettgqvyllsfisacpdfklrlmkdtqtisqtvalte
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w3mE (E:)
    avqlaesgpalvapsqalsitctvagfsltaygvawvrqppgaglewlgaiwaagatdyn
    aalksrasiakdnsksqvflamaslatadtaayycarewdaygdywgqgttvtvsa
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w3mG (G:)
    divltqspaalsaaagatvaatcrasgnihnalawyqqkagkspqllvyaaaalaagvps
    rfsgsgsgtayalainslaaddfgayycqhfwstpytfgggtkleik