PDB entry 5w3g

View 5w3g on RCSB PDB site
Description: Solution Structure of ETS Transcription Factor PU.1
Class: DNA binding protein
Keywords: winged helix-turn-helix, DNA BINDING PROTEIN
Deposited on 2017-06-07, released 2018-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription factor PU.1
    Species: Mus musculus [TaxId:10090]
    Gene: Spi1, Sfpi-1, Sfpi1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17433 (4-109)
      • expression tag (0-3)
    Domains in SCOPe 2.08: d5w3ga1, d5w3ga2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w3gA (A:)
    hihmgskkkirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnr
    kkmtyqkmaralrnygktgevkkvkkkltyqfsgevlgrgglaerrlpph