PDB entry 5w3g

View 5w3g on RCSB PDB site
Description: Solution Structure of ETS Transcription Factor PU.1
Class: DNA binding protein
Keywords: winged helix-turn-helix, DNA BINDING PROTEIN
Deposited on 2017-06-07, released 2018-06-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Transcription factor PU.1
  Species: Mus musculus [TaxId:10090]
  Gene: Spi1, Sfpi-1, Sfpi1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P17433 (4-109)
    • expression tag (0-3)
  Domains in SCOPe 2.08: d5w3ga1, d5w3ga2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >5w3gA (A:)
  hihmgskkkirlyqflldllrsgdmkdsiwwvdkdkgtfqfsskhkealahrwgiqkgnr
  kkmtyqkmaralrnygktgevkkvkkkltyqfsgevlgrgglaerrlpph