PDB entry 5w2w

View 5w2w on RCSB PDB site
Description: influenza virus neuraminidase n9 in complex with 8-deoxygenated 2,3-difluoro-n-acetylneuraminic acid
Class: hydrolase/hydrolase inhibitor
Keywords: INFLUENZA VIRUS NEURAMINIDASE, N9, COMPLEX, 2, 3-DIFLUOROSIALIC ACID, SECOND BINDING SITE, HYDROLASE, hydrolase-hydrolase inhibitor complex
Deposited on 2017-06-07, released 2018-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) [TaxId:384509]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w2wa_
  • Heterogens: 9SP, NAG, BMA, MAN, CA, 9SD, 9S7, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w2wA (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl