PDB entry 5w2b

View 5w2b on RCSB PDB site
Description: Crystal structure of C-terminal domain of Ebola (Reston) nucleoprotein in complex with Fab fragment
Class: viral protein/immune system
Keywords: Ebola virus, nucleoprotein, Fab, antibody-antigen interaction, VIRAL PROTEIN, viral protein-immune system complex
Deposited on 2017-06-06, released 2018-06-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-13, with a file datestamp of 2018-06-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Reston ebolavirus [TaxId:386032]
    Gene: NP
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W2B
  • Chain 'L':
    Compound: Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W2B
    Domains in SCOPe 2.07: d5w2bl1, d5w2bl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5w2bL (L:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqsssslitfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w2bL (L:)
    qmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvpsrf
    sgsrsgtdftltisslqpedfatyycqqsssslitfgqgtkveikrtvaapsvfifppsd
    sqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltls
    kadyekhkvyacevthqglsspvtksfnrg