PDB entry 5w26

View 5w26 on RCSB PDB site
Description: influenza virus neuraminidase n9 in complex with 4-deoxygenated 2,3-difluoro-n-acetylneuraminic acid
Class: hydrolase/hydrolase inhibitor
Keywords: INFLUENZA VIRUS NEURAMINIDASE, N9, COMPLEX, 4-DEOXYGENATED 2, 3-DIFLUORO-N-ACETYLNEURAMINIC ACID, SECOND BINDING SITE, HYDROLASE, hydrolase-hydrolase inhibitor complex
Deposited on 2017-06-05, released 2018-02-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-21, with a file datestamp of 2018-03-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus (strain A/Tern/Australia/G70C/1975 H11N9) [TaxId:384509]
    Gene: NA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w26a_
  • Heterogens: 9SG, NAG, BMA, MAN, CA, 9WM, 9VP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w26A (A:)
    rdfnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyraliswplsspptvynsrvecigwsstschdgktrmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvchngvcpvvftdgsatgpaetriyyfkeg
    kilkweplagtakhieecscygeraeitctcrdnwqgsnrpviridpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldgvntwlgrtisiasrsgyemlkvpn
    altddkskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwdwpdgakieyfl