PDB entry 5w1o

View 5w1o on RCSB PDB site
Description: Crystal Structure of HPV16 L1 Pentamer Bound to Heparin Oligosaccharides
Class: viral protein
Keywords: human papillomavirus, jelly roll, capsid protein, receptor HSPG, virus capsid, VIRAL PROTEIN
Deposited on 2017-06-04, released 2017-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Major capsid protein L1
    Species: Human papillomavirus [TaxId:10566]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (1-383)
      • expression tag (0)
      • linker (384-389)
    • Uniprot Q81007 (390-426)
    Domains in SCOPe 2.07: d5w1oa1, d5w1oa2
  • Chain 'B':
    Compound: Major capsid protein L1
    Species: Human papillomavirus [TaxId:10566]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (1-383)
      • expression tag (0)
      • linker (384-389)
    • Uniprot Q81007 (390-426)
    Domains in SCOPe 2.07: d5w1ob1, d5w1ob2
  • Chain 'C':
    Compound: Major capsid protein L1
    Species: Human papillomavirus [TaxId:10566]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (1-383)
      • expression tag (0)
      • linker (384-389)
    • Uniprot Q81007 (390-426)
    Domains in SCOPe 2.07: d5w1oc1, d5w1oc2
  • Chain 'D':
    Compound: Major capsid protein L1
    Species: Human papillomavirus [TaxId:10566]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (1-383)
      • expression tag (0)
      • linker (384-389)
    • Uniprot Q81007 (390-End)
    Domains in SCOPe 2.07: d5w1od1, d5w1od2
  • Chain 'E':
    Compound: Major capsid protein L1
    Species: Human papillomavirus [TaxId:10566]
    Gene: L1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81007 (1-383)
      • expression tag (0)
      • linker (384-389)
    • Uniprot Q81007 (390-End)
    Domains in SCOPe 2.07: d5w1oe1, d5w1oe2
  • Heterogens: JHM, IDS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w1oA (A:)
    avvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
    pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
    gvdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgd
    mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
    lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
    kitltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrk
    fllqagl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w1oB (B:)
    avvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
    pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
    gvdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgd
    mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
    lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
    kitltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrk
    fllqagl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5w1oC (C:)
    avvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
    pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
    gvdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgd
    mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
    lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
    kitltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrk
    fllqagl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w1oD (D:)
    avvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
    pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
    gvdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgd
    mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
    lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
    kitltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrk
    fllqagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1oD (D:)
    avvstdeyvartniyyhagtsrllavghpyfpikknnnkilvpkvsglqyrvfrihlpdp
    nkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaanag
    vdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgdm
    vdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrhl
    fnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqghn
    ngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlck
    itltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrkf
    llqag
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5w1oE (E:)
    avvstdeyvartniyyhagtsrllavghpyfpikkpnnnkilvpkvsglqyrvfrihlpd
    pnkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaana
    gvdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgd
    mvdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrh
    lfnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqgh
    nngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlc
    kitltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrk
    fllqagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1oE (E:)
    avvstdeyvartniyyhagtsrllavghpyfpikkpnnkilvpkvsglqyrvfrihlpdp
    nkfgfpdtsfynpdtqrlvwacvgvevgrgqplgvgisghpllnklddtenasayaanag
    vdnrecismdykqtqlcligckppigehwgkgspctnvavnpgdcpplelintviqdgdm
    vdtgfgamdfttlqanksevpldictsickypdyikmvsepygdslffylrreqmfvrhl
    fnragtvgenvpddlyikgsgstanlassnyfptpsgsmvtsdaqifnkpywlqraqghn
    ngicwgnqlfvtvvdttrstnmslcaaistsettykntnfkeylrhgeeydlqfifqlck
    itltadvmtyihsmnstiledwngggsgaedplkkytfwevnlkekfsadldqfplgrkf
    llqag