PDB entry 5w1g

View 5w1g on RCSB PDB site
Description: CR1-07 unliganded Fab
Class: immune system
Keywords: Fab, antibody, Machupo virus, Junin virus, arenavirus, IMMUNE SYSTEM
Deposited on 2017-06-03, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: CR1-07 Fab heavy chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W1G (0-222)
  • Chain 'L':
    Compound: CR1-07 Fab light chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5W1G (0-End)
    Domains in SCOPe 2.07: d5w1gl1, d5w1gl2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5w1gL (L:)
    divmtqspeslavslgeratinckssqsvlyssrsdnkdylawyqqkpgqspklliywas
    tresgvperftgsgsgtdftlsisslqaedvavyycqqyysspptfgggtkvelkrtvaa
    psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
    yslsstltlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1gL (L:)
    divmtqspeslavslgeratinckssqsvlyssrsdnkdylawyqqkpgqspklliywas
    tresgvperftgsgsgtdftlsisslqaedvavyycqqyysspptfgggtkvelkrtvaa
    psvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdst
    yslsstltlskadyekhkvyacevthqglsspvtksfnrge