PDB entry 5w1f

View 5w1f on RCSB PDB site
Description: Crystal structure of Ni(II)- and Ca(II)-bound human calprotectin
Class: metal binding protein
Keywords: calprotectin, innate immunity, metal sequestration, nickel, calcium, S100 protein, METAL BINDING PROTEIN
Deposited on 2017-06-03, released 2017-06-14
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-06-14, with a file datestamp of 2017-06-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d5w1fa_
  • Chain 'B':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5w1fb_
  • Chain 'C':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d5w1fc_
  • Chain 'D':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5w1fd_
  • Chain 'E':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d5w1fe_
  • Chain 'F':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5w1ff_
  • Chain 'G':
    Compound: Protein S100-A8
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A8, CAGA, CFAG, MRP8
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05109 (0-End)
      • engineered mutation (41)
    Domains in SCOPe 2.06: d5w1fg_
  • Chain 'H':
    Compound: Protein S100-A9
    Species: Homo sapiens [TaxId:9606]
    Gene: S100A9, CAGB, CFAG, MRP14
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5w1fh_
  • Heterogens: NA, CA, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w1fA (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1fA (A:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w1fB (B:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1fB (B:)
    msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime
    dldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w1fC (C:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1fC (C:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w1fD (D:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1fD (D:)
    msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime
    dldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgeg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >5w1fE (E:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1fE (E:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5w1fF (F:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1fF (F:)
    msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime
    dldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >5w1fG (G:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkksheeshke
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1fG (G:)
    mltelekalnsiidvyhkyslikgnfhavyrddlkklletespqyirkkgadvwfkeldi
    ntdgavnfqeflilvikmgvaahkkshe
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >5w1fH (H:)
    mtskmsqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekvie
    himedldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglgegtp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1fH (H:)
    msqlernietiintfhqysvklghpdtlnqgefkelvrkdlqnflkkenknekviehime
    dldtnadkqlsfeefimlmarltwashekmhegdegpghhhkpglge