PDB entry 5w1b

View 5w1b on RCSB PDB site
Description: Tryptophan indole-lyase
Class: lyase
Keywords: pyridoxal-5'-phosphate, aminotransferase fold, tryptophan metabolism, LYASE
Deposited on 2017-06-02, released 2018-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-06, with a file datestamp of 2018-06-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophanase
    Species: Proteus vulgaris [TaxId:585]
    Gene: tnaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w1ba_
  • Chain 'B':
    Compound: tryptophanase
    Species: Proteus vulgaris [TaxId:585]
    Gene: tnaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w1bb_
  • Chain 'C':
    Compound: tryptophanase
    Species: Proteus vulgaris [TaxId:585]
    Gene: tnaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w1bc_
  • Chain 'D':
    Compound: tryptophanase
    Species: Proteus vulgaris [TaxId:585]
    Gene: tnaA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w1bd_
  • Heterogens: K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w1bA (A:)
    makrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdh
    qwaamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegk
    aknpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhg
    adnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpk
    yknatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvt
    ygglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdck
    klvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarr
    vytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1bA (A:)
    akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
    waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
    knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
    dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
    knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
    gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
    lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
    ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5w1bB (B:)
    makrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdh
    qwaamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegk
    aknpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhg
    adnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpk
    yknatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvt
    ygglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdck
    klvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarr
    vytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1bB (B:)
    akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
    waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
    knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
    dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
    knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
    gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
    lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
    ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5w1bC (C:)
    makrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdh
    qwaamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegk
    aknpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhg
    adnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpk
    yknatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvt
    ygglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdck
    klvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarr
    vytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1bC (C:)
    akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
    waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
    knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
    dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
    knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
    gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
    lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
    ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5w1bD (D:)
    makrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdh
    qwaamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegk
    aknpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhg
    adnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpk
    yknatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvt
    ygglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdck
    klvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarr
    vytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w1bD (D:)
    akrivepfrikmvekirvpsreereaalkeagynpfllpssavyidlltdsgtnamsdhq
    waamitgdeayagsrnyydlkdkakelfnydyiipahqgrgaenilfpvllkykqkegka
    knpvfisnfhfdttaahvelngckainivtekafdsetyddwkgdfdikklkeniaqhga
    dnivaivstvtcnsaggqpvsmsnlkevyeiakqhgifvvmdsarfcenayfikardpky
    knatikevifdmykyadaltmsakkdpllnigglvairdneeiftlarqrcvpmegfvty
    gglagrdmaamvqgleegteeeylhyrigqvkylgdrlreagipiqyptgghavfvdckk
    lvpqipgdqfpaqavinalylesgvraveigsfllgrdpatgeqkhadmefmrltiarrv
    ytndhmdyiadaliglkekfatlkglefeyeppvlrhftarlkpie