PDB entry 5w0q

View 5w0q on RCSB PDB site
Description: CREBBP Bromodomain in complex with Cpd17 (N,2,7-trimethyl-2,3-dihydro-4H-benzo[b][1,4]oxazine-4-carboxamide)
Class: transcription regulator/inhibitor
Keywords: CREBBP, Bromodomain, small molecule inhibitor, TRANSFERASE-INHIBITOR complex, TRANSCRIPTION REGULATOR-INHIBITOR complex
Deposited on 2017-05-31, released 2018-03-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-03-07, with a file datestamp of 2018-03-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5w0qa_
  • Heterogens: SO4, 9UG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w0qA (A:)
    mhhhhhhgslvprgsmdykddddkenlyfqgskkifkpeelrqalmptlealyrqdpesl
    pfrqpvdpqllgipdyfdivknpmdlstikrkldtgqyqepwqyvddvwlmfnnawlynr
    ktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w0qA (A:)
    kkifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrk
    ldtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqslg