PDB entry 5w0g

View 5w0g on RCSB PDB site
Description: Structure of U2AF65 (U2AF2) RRM1 at 1.07 resolution
Class: RNA binding protein/RNA
Keywords: RNA SPLICING FACTOR, RNA RECOGNITION MOTIF, RRM, POLYPYRIMIDINE TRACT, RNA BINDING PROTEIN, RNA BINDING PROTEIN-RNA complex
Deposited on 2017-05-30, released 2018-04-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-11, with a file datestamp of 2018-04-06.
Experiment type: XRAY
Resolution: 1.07 Å
R-factor: N/A
AEROSPACI score: 0.76 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: splicing factor u2af 65 kda subunit
    Species: Homo sapiens [TaxId:9606]
    Gene: U2AF2, U2AF65
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26368 (5-86)
      • expression tag (2-4)
    Domains in SCOPe 2.07: d5w0ga1, d5w0ga2
  • Heterogens: ZN, ACT, 1PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w0gA (A:)
    gplgsarrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqdknfaflef
    rsvdettqamafdgiifqgqslkirrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w0gA (A:)
    lgsarrlyvgnipfgiteeammdffnaqmrlggltqapgnpvlavqinqknfaflefrsv
    dettqamafdgiifqgqslkirrp