PDB entry 5w0e

View 5w0e on RCSB PDB site
Description: CREBBP bromodomain in complex with Cpd19 (3-(7-(difluoromethyl)-6-(1-methyl-1H-pyrazol-4-yl)-3,4-dihydroquinolin-1(2H)-yl)-N-methyl-1-(tetrahydro-2H-pyran-4-yl)-1,4,6,7-tetrahydro-5H-pyrazolo[4,3-c]pyridine-5-carboxamide)
Class: transcription regulator/inhibitor
Keywords: CREBBP, Bromodomain, small molecule inhibitor, TRANSCRIPTION REGULATOR-INHIBITOR complex
Deposited on 2017-05-30, released 2018-02-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-02-21, with a file datestamp of 2018-02-16.
Experiment type: XRAY
Resolution: 1.41 Å
R-factor: N/A
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: creb-binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: CREBBP, CBP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d5w0ea_
  • Heterogens: 9U4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5w0eA (A:)
    mhhhhhhgslvprgsmdykddddkenlyfqgskkifkpeelrqalmptlealyrqdpesl
    pfrqpvdpqllgipdyfdivknpmdlstikrkldtgqyqepwqyvddvwlmfnnawlynr
    ktsrvykfcsklaevfeqeidpvmqslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5w0eA (A:)
    kifkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkl
    dtgqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl