PDB entry 5vzn

View 5vzn on RCSB PDB site
Description: Wild-type sperm whale myoglobin with nitric oxide
Class: oxygen transport
Keywords: Heme, Myoglobin, nitrosyl, nitric oxide, OXYGEN TRANSPORT
Deposited on 2017-05-29, released 2018-06-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-27, with a file datestamp of 2019-11-22.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon [TaxId:9755]
    Gene: MB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185
      • variant (122)
    Domains in SCOPe 2.08: d5vzna_
  • Heterogens: HEM, NO, SO4, NO2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >5vznA (A:)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg

    Sequence, based on observed residues (ATOM records): (download) 
    >5vznA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gnfgadaqgamnkalelfrkdiaakykelgy