PDB entry 5vz6

View 5vz6 on RCSB PDB site
Description: HIV Reverse Transcriptase complexed with (E)-3-(pyrimidin-2-yl)-N-(5-(5,6,7,8-tetrahydronaphthalen-2-yl)-1H-pyrazol-3-yl)acrylamide
Class: transferase/inhibitor
Keywords: HIV, RT, Reverse Transcriptase, TRANSFERASE-INHIBITOR complex
Deposited on 2017-05-26, released 2018-05-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-05-30, with a file datestamp of 2018-05-25.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV Reverse transcriptase
    Species: Human immunodeficiency virus type 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vz6a1, d5vz6a2, d5vz6a3
  • Chain 'B':
    Compound: HIV Reverse transcriptase
    Species: Human immunodeficiency virus type 1 [TaxId:11676]
    Gene: gag-pol
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vz6b_
  • Heterogens: 9TV, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vz6A (A:)
    mnspispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyn
    tpvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfs
    vpldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpd
    iviyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpd
    kwtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplte
    eaelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarm
    rgahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefv
    ntpplvklwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqkt
    elqaiylalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvp
    ahkgiggneqvdklvsagirkvl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vz6A (A:)
    spispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntp
    vfaiktkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvplded
    frkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqy
    mddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpdkwtvqp
    ivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplteeaelel
    aenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarmrgahtn
    dvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefvntpplv
    klwyqlekepivgaetfyvdgaanretklgkagyvtnrgrqkvvtltdttnqktelqaiy
    lalqdsglevnivtdsqyalgiiqaqpdqseselvnqiieqlikkekvylawvpahkgig
    gneqvdklvsagir
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vz6B (B:)
    mnspispietvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyn
    tpvfaikkkdstkwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfs
    vpldedfrkytaftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpd
    iviyqymddlyvgsdleigqhrtkieelrqhllrwglttpdkkhqkeppflwmgyelhpd
    kwtvqpivlpekdswtvndiqklvgklnwasqiypgikvrqlckllrgtkalteviplte
    eaelelaenreilkepvhgvyydpskdliaeiqkqgqgqwtyqiyqepfknlktgkyarm
    rgahtndvkqlteavqkittesiviwgktpkfklpiqketwetwwteywqatwipewefv
    ntpplvklwyqlekepivgaetf
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vz6B (B:)
    etvpvklkpgmdgpkvkqwplteekikalveictemekegkiskigpenpyntpvfaikt
    kwrklvdfrelnkrtqdfwevqlgiphpaglkkkksvtvldvgdayfsvpldedfrkyta
    ftipsinnetpgiryqynvlpqgwkgspaifqssmtkilepfrkqnpdiviyqymddlyv
    gsdleigqhrtkieelrqhllrwgltgyelhpdkwtvqpivlpekdswtvndiqklvgkl
    nwasqiypgikvrqlckllrgtkalteviplteeaelelaenreilkepvhgvyydpskd
    liaeiqkqgqgqwtyqiyqepfknlktgkyarhtndvkqlteavqkittesiviwgktpk
    fklpiqketwetwwteywqatwipewefvntpplvklwyq