PDB entry 5vz1

View 5vz1 on RCSB PDB site
Description: Crystal structure of the Apo Antibody fragment (Fab) raised against C-terminal domain of Ebola nucleoprotein (EBOV, TAFV, BDBV strains)
Class: immune system
Keywords: Ebola virus, Nucleoprotein, Fab, Antibody fragment, IMMUNE SYSTEM
Deposited on 2017-05-26, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Apo Antibody Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZ1
    Domains in SCOPe 2.07: d5vz1a1, d5vz1a2
  • Chain 'B':
    Compound: Apo Antibody Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZ1
  • Chain 'C':
    Compound: Apo Antibody Fab Light Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZ1
    Domains in SCOPe 2.07: d5vz1c1, d5vz1c2
  • Chain 'D':
    Compound: Apo Antibody Fab Heavy Chain
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VZ1
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vz1A (A:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqysyslvtfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vz1A (A:)
    tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliyssrfsgsrsgtdftl
    tisslqpedfatyycqqysyslvtfgqgtkveikrtvaapsvfifppsdsqlksgtasvv
    cllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvya
    cevthqglsspvtksfnrge
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vz1C (C:)
    sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
    srfsgsrsgtdftltisslqpedfatyycqqysyslvtfgqgtkveikrtvaapsvfifp
    psdsqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstl
    tlskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vz1C (C:)
    tqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapkllsrfsgsrsgtdftltis
    slqpedfatyycqqysyslvtfgqgtkveikrtvaapsvfifppsdsqlksgtasvvcll
    nnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltlskadyekhkvyacev
    thqglsspvtksfnrg
    

  • Chain 'D':
    No sequence available.