PDB entry 5vyy

View 5vyy on RCSB PDB site
Description: Structure of human Hsp90-alpha bound to resorcinylic inhibitor BnIm
Class: chaperone/inhibitor
Keywords: chaperone, chaperone-inhibitor, CHAPERONE-INHIBITOR complex
Deposited on 2017-05-26, released 2018-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-18, with a file datestamp of 2018-04-13.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heat shock protein HSP 90-alpha
    Species: Homo sapiens [TaxId:9606]
    Gene: HSP90AA1, HSP90A, HSPC1, HSPCA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vyya_
  • Heterogens: 9QY, FMT, EDO, MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vyyA (A:)
    mgsshhhhhhssglvprgshmpeetqtqdqpmeeeevetfafqaeiaqlmsliintfysn
    keiflrelisnssdaldkiryesltdpskldsgkelhinlipnkqdrtltivdtgigmtk
    adlinnlgtiaksgtkafmealqagadismigqfgvgfysaylvaekvtvitkhnddeqy
    awessaggsftvrtdtgepmgrgtkvilhlkedqteyleerrikeivkkhsqfigypitl
    fvekerdkevsddeae
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyyA (A:)
    evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
    lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
    vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
    eyleerrikeivkkhsqfigypitlfve