PDB entry 5vyf

View 5vyf on RCSB PDB site
Description: Structure of single chain Fel d 1 bound to a neutralizing antibody
Class: immune system
Keywords: antibody, allergen, therapeutic, IMMUNE SYSTEM
Deposited on 2017-05-25, released 2018-04-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VYF (0-End)
    Domains in SCOPe 2.07: d5vyfa1, d5vyfa2
  • Chain 'B':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VYF
  • Chain 'C':
    Compound: Chimera of Major allergen I polypeptide chain 2,Major allergen I polypeptide chain 1
    Species: Felis catus [TaxId:9685]
    Gene: CH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30440
      • engineered mutation (32)
    • Uniprot P30438 (Start-161)
      • variant (151)
    Domains in SCOPe 2.07: d5vyfc1, d5vyfc2
  • Chain 'F':
    Compound: Chimera of Major allergen I polypeptide chain 2,Major allergen I polypeptide chain 1
    Species: Felis catus [TaxId:9685]
    Gene: CH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30440
      • engineered mutation (32)
    • Uniprot P30438 (Start-161)
      • variant (151)
    Domains in SCOPe 2.07: d5vyff1, d5vyff2
  • Chain 'H':
    Compound: antibody fab heavy chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VYF (0-End)
  • Chain 'L':
    Compound: Antibody Light Chain
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VYF (0-End)
    Domains in SCOPe 2.07: d5vyfl1, d5vyfl2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vyfA (A:)
    diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykasslesgvps
    rfsgsgsgtdftltisslrpedfatyycqqynsypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyfA (A:)
    diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykasslesgvps
    rfsgsgsgtdftltisslrpedfatyycqqynsypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vyfC (C:)
    vkmaetcpifydvffavangnellldlsltkvaatepertamkkiqdcyvenglisrvld
    glvmttissskdcmgeavqntvedlklntlgreicpavkrdvdlfltgtpdeyveqvaqy
    kalpvvlenarilkncvdakmteedkenalslldkiytsplcgpggeqkliseedlggeq
    kliseedlsghhhhhhssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyfC (C:)
    cpifydvffavangnellldlsltkvaatepertamkkiqdcyvenglisrvldglvmtt
    issskdcicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteedk
    enalslldkiytsplc
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >5vyfF (F:)
    vkmaetcpifydvffavangnellldlsltkvaatepertamkkiqdcyvenglisrvld
    glvmttissskdcmgeavqntvedlklntlgreicpavkrdvdlfltgtpdeyveqvaqy
    kalpvvlenarilkncvdakmteedkenalslldkiytsplcgpggeqkliseedlggeq
    kliseedlsghhhhhhssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyfF (F:)
    tcpifydvffavangnellldlsltkvaatepertamkkiqdcyvenglisrvldglvmt
    tissskdcicpavkrdvdlfltgtpdeyveqvaqykalpvvlenarilkncvdakmteed
    kenalslldkiytsplc
    

  • Chain 'H':
    No sequence available.

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >5vyfL (L:)
    diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykasslesgvps
    rfsgsgsgtdftltisslrpedfatyycqqynsypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrgec
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyfL (L:)
    diqmtqspstlsasvgdrvtitcrasqsisswlawyqqkpgkapklliykasslesgvps
    rfsgsgsgtdftltisslrpedfatyycqqynsypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge