PDB entry 5vye

View 5vye on RCSB PDB site
Description: Crystal Structure of L-Threonine Aldolase from Pseudomonas putida
Class: lyase
Keywords: PLP, threonine aldolase, L-threonine aldolase, aldolase, LYASE
Deposited on 2017-05-25, released 2018-06-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-06-27, with a file datestamp of 2018-06-22.
Experiment type: XRAY
Resolution: 2.28 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: L-threonine aldolase
    Species: Pseudomonas putida [TaxId:303]
    Gene: A3L25_23170, B7H18_06210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vyea_
  • Chain 'B':
    Compound: L-threonine aldolase
    Species: Pseudomonas putida [TaxId:303]
    Gene: A3L25_23170, B7H18_06210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vyeb_
  • Chain 'C':
    Compound: L-threonine aldolase
    Species: Pseudomonas putida [TaxId:303]
    Gene: A3L25_23170, B7H18_06210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vyec_
  • Chain 'D':
    Compound: L-threonine aldolase
    Species: Pseudomonas putida [TaxId:303]
    Gene: A3L25_23170, B7H18_06210
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vyed_
  • Heterogens: PLR, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vyeA (A:)
    mtdksqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevff
    afngtaanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpq
    sirevalkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftn
    acaflgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlask
    mrflsapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpeha
    iealrakgwrfytfigsggarfmcswdteeervrelaadirsiita
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyeA (A:)
    ksqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevffafn
    gtaanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpqsir
    evalkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftnaca
    flgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlaskmrf
    lsapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpehaiea
    lrakgwrfytfigsggarfmcswdteeervrelaadirsiita
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vyeB (B:)
    mtdksqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevff
    afngtaanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpq
    sirevalkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftn
    acaflgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlask
    mrflsapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpeha
    iealrakgwrfytfigsggarfmcswdteeervrelaadirsiita
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyeB (B:)
    dksqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevffaf
    ngtaanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpqsi
    revalkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftnac
    aflgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlaskmr
    flsapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpehaie
    alrakgwrfytfigsggarfmcswdteeervrelaadirsiita
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >5vyeC (C:)
    mtdksqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevff
    afngtaanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpq
    sirevalkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftn
    acaflgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlask
    mrflsapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpeha
    iealrakgwrfytfigsggarfmcswdteeervrelaadirsiita
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyeC (C:)
    sqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevffafng
    taanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpqsire
    valkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftnacaf
    lgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlaskmrfl
    sapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpehaieal
    rakgwrfytfigsggarfmcswdteeervrelaadirsiita
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >5vyeD (D:)
    mtdksqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevff
    afngtaanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpq
    sirevalkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftn
    acaflgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlask
    mrflsapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpeha
    iealrakgwrfytfigsggarfmcswdteeervrelaadirsiita
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vyeD (D:)
    sqqfasdnysgicpeawaamekanhghdraygddqwteraseyfrnlfetdcevffafng
    taanslalaslcqsyhsvicsetahvetdecgapeffsngsklltaasvngkltpqsire
    valkrqdihypkprvvtitqatevgtvyrpdelkaisatckelglnlhmdgarftnacaf
    lgcspaeltwkagvdvlcfggtkngmavgeailffnrqlaedfdyrckqagqlaskmrfl
    sapwvglledgawlrhgnhanhcaqllallvsdlpgvelmfpveangvflqmpehaieal
    rakgwrfytfigsggarfmcswdteeervrelaadirsiita