PDB entry 5vxm

View 5vxm on RCSB PDB site
Description: 2.05 A resolution structure of IpaD from Shigella flexneri in complex with single-domain antibody 20ipaD
Class: immune system
Keywords: tip protein, VHH, T3SS, IMMUNE SYSTEM
Deposited on 2017-05-23, released 2017-08-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2017-08-30, with a file datestamp of 2017-08-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: invasin ipad
    Species: Shigella flexneri [TaxId:623]
    Gene: ipaD, CP0126
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d5vxma_
  • Chain 'B':
    Compound: Single-domain antibody 20ipaD
    Species: Vicugna pacos [TaxId:30538]
    Database cross-references and differences (RAF-indexed):
    • PDB 5VXM
    Domains in SCOPe 2.06: d5vxmb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vxmA (A:)
    gstgshpvssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksa
    qlldilsrneypinkdarellhsapkeaeldgdqmishrelwakiansindineqylkvy
    ehavssytqmyqdfsavlsslagwispggndgnsvklqvnslkkaleelkekykdkplyp
    anntvsqeqankwltelggtigkvsqknggyvvsinmtpidnmlksldnlggngevvldn
    akyqawnagfsaedetmknnlqtlvqkysnansifdnlvkvlsstisss
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vxmA (A:)
    ssltmlndtlhnirttnqalkkelsqktltktsleeialhssqismdvnksaqllarell
    hkeakiansindineqylkvyehavssytqmyqdfsavlsslagwispgsvklqvnslkk
    aleelkekykdkplypanntvsqeqankwltelggtigkvsqknggyvvsinmtpidnml
    ksldnlggngevvldnakyqawnagfsaedetmknnlqtlvqkysnansifdnlvkvlss
    tis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vxmB (B:)
    gstqvqlvesggglvqaggslrlscavsglemqshaigwfrqapgkeregvscinddgst
    tryadsvkgrftisrdnakntvylqmnslkpedtavyfcaaksvwfcsvirshefnswgq
    gtqvtvssahhsedpsarqgapvpypdplep
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vxmB (B:)
    vqlvesggglvqaggslrlscavsglemqshaigwfrqapgkeregvscinddgsttrya
    dsvkgrftisrdnakntvylqmnslkpedtavyfcaaksvwfcsvirshefnswgqgtqv
    tvssa