PDB entry 5vx9

View 5vx9 on RCSB PDB site
Description: VP8* of P[6] Human Rotavirus RV3 in complex with LNFP1
Class: viral protein
Keywords: Glycan, HBGA, rotavirus, VIRAL PROTEIN
Deposited on 2017-05-23, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed):
    • Uniprot D7F7M7 (2-160)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5vx9a1, d5vx9a2
  • Heterogens: FUC, GAL, NAG, BGC, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vx9A (A:)
    gsldgpyqstsfkppsdywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlf
    getkqitvenntnkwkffemfrssvsaefqhkrtltsdtklagflkhynsvwtfhgetph
    attdysstsnlsevettihvefyiiprsqeskcveyintgl