PDB entry 5vx8

View 5vx8 on RCSB PDB site
Description: VP8* of P[6] Human Rotavirus RV3
Class: viral protein
Keywords: Glycan, HBGA, rotavirus, VIRAL PROTEIN
Deposited on 2017-05-23, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vx8a_
  • Chain 'B':
    Compound: Outer capsid protein VP4
    Species: Human rotavirus A [TaxId:10941]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d5vx8b_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >5vx8A (A:)
    gsldgpyqstsfkppsdywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlf
    getkqitvenntnkwkffemfrssvsaefqhkrtltsdtklagflkhynsvwtfhgetph
    attdysstsnlsevettihvefyiiprsqeskcveyintgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vx8A (A:)
    ldgpyqstsfkppsdywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfge
    tkqitvenntnkwkffemfrssvsaefqhkrtltsdtklagflkhynsvwtfhgetphat
    tdysstsnlsevettihvefyiiprsqeskcveyintgl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >5vx8B (B:)
    gsldgpyqstsfkppsdywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlf
    getkqitvenntnkwkffemfrssvsaefqhkrtltsdtklagflkhynsvwtfhgetph
    attdysstsnlsevettihvefyiiprsqeskcveyintgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >5vx8B (B:)
    ldgpyqstsfkppsdywillnptnqqvvlegtnktdiwvalllvepnvtnqsrqytlfge
    tkqitvenntnkwkffemfrssvsaefqhkrtltsdtklagflkhynsvwtfhgetphat
    tdysstsnlsevettihvefyiiprsqeskcveyintgl