PDB entry 5vx4

View 5vx4 on RCSB PDB site
Description: VP8* of a G2P[4] Human Rotavirus
Class: viral protein
Keywords: Glycan, HBGA, rotavirus, VIRAL PROTEIN
Deposited on 2017-05-23, released 2018-07-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2018-07-18, with a file datestamp of 2018-07-13.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Outer capsid protein VP4
    Species: Rotavirus A [TaxId:28875]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q2VE61 (2-161)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d5vx4a1, d5vx4a2
  • Heterogens: TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >5vx4A (A:)
    gsildgpyqpttfkppndywllissntdgvvyestnnsdfwtaviavephvsqtnrqyvl
    fgenkqfnvenssdkwkffemfkgssqsdfsnrrtltsnnrlvgmlkyggrvwtfhgetp
    rattdssntadlnnisiiihsefyiiprsqeskcneyinngl